PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna09220.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family NF-YC
Protein Properties Length: 350aa    MW: 38048.3 Da    PI: 4.7896
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna09220.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC59.57.2e-196861898
                    NF-YC 18 nhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98
                             ++++P arikki+++dedv +i+  +P l+ska elf+ +l  r++  + +   +t++   ++++v+  ++fdfl div +
  mrna09220.1-v1.0-hybrid  6 DTRFPAARIKKIMQTDEDVGKIALAVPLLVSKALELFLQDLCDRTYEITLKRGAKTMNSLHLKQCVKTFNVFDFLKDIVSK 86
                             5789**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.104.0E-25372IPR009072Histone-fold
SuperFamilySSF471136.01E-19488IPR009072Histone-fold
PfamPF008089.6E-19871IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MRKKLDTRFP AARIKKIMQT DEDVGKIALA VPLLVSKALE LFLQDLCDRT YEITLKRGAK  60
TMNSLHLKQC VKTFNVFDFL KDIVSKVPDL GGSDAVGDEC SVAKRRKVSV DDEDTESDDE  120
TKRSKMMIDG GNTVGSGRGR GRGRGRGRKL VADDEDTDTD EESKASMMVH DAGNTPGSGR  180
GRGRGRGRPR GRPRGSRTVG REISAPNEKY EDDLDISKHE DKLDEPLELR DDAIEPKGSK  240
ENISGANSAE IAARNFDLNV DLNENEDSAT TSAAVHGPVP APSTATATAT ATATAPVPAN  300
LSSQFTPDMK HVEFLGWPLT GMETMAIDPV QLANLTRKID EDEEDYDED*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_A3e-21272575Transcription Regulator NC2 alpha chain
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1137146RGRGRGRGRG
2183193RGRGRPRGRPR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004307150.10.0PREDICTED: myoneurin-like
STRINGVIT_06s0009g02120.t016e-84(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17283491
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12480.15e-55nuclear factor Y, subunit C11